Kennis

meer inligting oor hoe om 'n sonpaneelfabriek te begin

Voor- en nadele van dun-film sonselle

Voor- en nadele van dun-film sonselle

Dunfilm-sonselle word wyd gebruik in fotovoltaïese landboukweekhuise en fotovoltaïese fasiliteite wat ligtransmissie benodig. Weet jy wat is die voordele en nadele van dunfilm sonselle? Hoeveel jaar hou hierdie dunfilm sonpaneel?

Tans sluit die bestaande dun-film sonselle hoofsaaklik in: kadmium telluride dun-film sonselle, koper indium gallium selenied dun-film sonselle, en amorfe silikon dun-film sonselle.

1. Voordele van dun-film sonselle

(1) Die waarde van sonlig met 'n hoë absorpsietempo.

GaAs behoort aan III-V saamgestelde halfgeleier materiale, en sy energie gaping is 1.4eV, wat net die waarde is van hoë absorpsietempo sonlig, wat meer geskik is om by die sonspektrum te pas.


(2) Hoë temperatuur weerstand.

Onder die toestand van 250 °C is die foto-elektriese omskakelingsprestasie steeds baie goed, en sy hoogste foto-elektriese omskakelingsdoeltreffendheid is ongeveer 30%, wat veral geskik is vir hoë-temperatuur konsentreer dunfilm sonselle.


(3) Laer koste.

Deur silikonwafels as substrate te gebruik, is die heteroepitaksiale metode van MOCVD-tegnologie 'n belowende metode om die koste van GaAs-selle te verminder.

 Voor- en nadele van dun-film sonselle


2. Nadele van dun-film sonselle

(1) Maklik ontsmet.

Die groeimeganisme van dunfilmsonselle bepaal dat dunfilmsonselle geneig is om te vervloei, dus is die waterweerstand van fluoorbevattende materiale wat nodig is om dunfilmsonselle in te kapsuleer ongeveer 9 keer sterker as dié van kristallyne silikonselle.


(2) Fotogeïnduseerde verswakking.

Die verswakking van dunfilm sonselle is ongeveer 30%.


(3) Die omskakelingsdoeltreffendheid van dunfilmsonselle is laag.

As gevolg van die hoë omskakelingsdoeltreffendheid van membraansonselle, verskyn die meeste daarvan slegs in kleinskaalse en buigsame elektroniese produkte.


(4) Kadmiumtelluried in die produksiemateriaal is 'n giftige stof.

Kadmium is 'n hoogs giftige stof wat soos kwik in die voedselketting ophoop, wat strydig is met die konsep van omgewingsvriendelik, veilig en nie-giftig. Baie instellings en laboratoriums is op soek na omgewingsvriendelike, hoë-doeltreffende alternatiewe, en sonkragvervaardigers ondersoek maniere om kadmiumbevattende materiaal te herwin en te herwin om omgewingsprobleme op te los.




How to Start a Solar Panel Manufacturing Company? Step 2

Hoe om 'n sonpaneelvervaardigingsmaatskappy te begin? Stap 2

Werkswinkel uitleg Produksie Ontwerp

LEES MEER
How to Start a Solar Panel Manufacturing Company? Step 4

Hoe om 'n sonpaneelvervaardigingsmaatskappy te begin? Stap 4

Masjiene Grondstowwe aankoop

LEES MEER
Solar Panel Bussing Machine Full Auto Interconnection Sordering Machine

Sonpaneel-bussmasjien Vol outomatiese interkonneksie-sorteermasjien

sonsnare railsweiswerk na opleg

LEES MEER
Solar Cell NDC Machine Solar Cell TLS Cutting Machine

Solar Cell NDC Masjien Solar Cell TLS Snymasjien

Nie-vernietigende snymasjien termiese laser skeiding snymasjien

LEES MEER
How to Start a Solar Panel Manufacturing Company? Step 6

Hoe om 'n sonpaneelvervaardigingsmaatskappy te begin? Stap 6

Installasie en opleiding

LEES MEER
Solar Cell Tester Solar Cell Sun Simulator combined 156 to 230 Solar Cell

Sonseltoetser Sonsel-sonsimulator gekombineer 156 tot 230 sonnesel

Solar Cell IV Toets voor Tabb

LEES MEER
How to Start a Solar Panel Manufacturing Company? Step 7

Hoe om 'n sonpaneelvervaardigingsmaatskappy te begin? Stap 7

Onderhoud en Nadiens

LEES MEER

Kom ons verander jou idee in werklikheid

Kindky lig ons die volgende besonderhede in, dankie!

Alle oplaaie is veilig en vertroulik